PDB entry 4gze

View 4gze on RCSB PDB site
Description: Crystal structure of 6-phospho-beta-glucosidase from Lactobacillus plantarum (apo form)
Class: hydrolase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, glycoside hydrolase, family 1, HYDROLASE
Deposited on 2012-09-06, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.174
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phospho-beta-glucosidase
    Species: Lactobacillus plantarum [TaxId:220668]
    Gene: lp_0440, pbg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot F9UU25 (3-480)
      • expression tag (2)
    Domains in SCOPe 2.07: d4gzea1, d4gzea2
  • Chain 'B':
    Compound: 6-phospho-beta-glucosidase
    Species: Lactobacillus plantarum [TaxId:220668]
    Gene: lp_0440, pbg1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gzeb_
  • Chain 'C':
    Compound: 6-phospho-beta-glucosidase
    Species: Lactobacillus plantarum [TaxId:220668]
    Gene: lp_0440, pbg1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gzec_
  • Chain 'D':
    Compound: 6-phospho-beta-glucosidase
    Species: Lactobacillus plantarum [TaxId:220668]
    Gene: lp_0440, pbg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot F9UU25 (3-480)
      • expression tag (2)
    Domains in SCOPe 2.07: d4gzed1, d4gzed2
  • Chain 'E':
    Compound: 6-phospho-beta-glucosidase
    Species: Lactobacillus plantarum [TaxId:220668]
    Gene: lp_0440, pbg1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gzee_
  • Chain 'F':
    Compound: 6-phospho-beta-glucosidase
    Species: Lactobacillus plantarum [TaxId:220668]
    Gene: lp_0440, pbg1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gzef_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gzeA (A:)
    snamtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvva
    gkyypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddl
    fdeclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmt
    fneinnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfq
    igcmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnldit
    aedlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglr
    yamnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdl
    igytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaei
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzeA (A:)
    amtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvvagk
    yypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfd
    eclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfn
    einnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqig
    cmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditae
    dlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglrya
    mnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdlig
    ytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gzeB (B:)
    snamtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvva
    gkyypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddl
    fdeclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmt
    fneinnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfq
    igcmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnldit
    aedlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglr
    yamnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdl
    igytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaei
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzeB (B:)
    tikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvvagkyy
    pnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfdec
    lkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfnei
    nnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqigcm
    iamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditaedl
    kilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkaqvdpvglryamnwftdr
    yhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdligytpwgci
    dlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gzeC (C:)
    snamtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvva
    gkyypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddl
    fdeclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmt
    fneinnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfq
    igcmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnldit
    aedlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglr
    yamnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdl
    igytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaei
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzeC (C:)
    tikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvvagkyy
    pnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfdec
    lkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfnei
    nnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqigcm
    iamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditaedl
    kilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdgwqvdpvglryamnw
    ftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdligytp
    wgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gzeD (D:)
    snamtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvva
    gkyypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddl
    fdeclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmt
    fneinnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfq
    igcmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnldit
    aedlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglr
    yamnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdl
    igytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaei
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzeD (D:)
    amtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvvagk
    yypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfd
    eclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfn
    einnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqig
    cmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditae
    dlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglrya
    mnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdlig
    ytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gzeE (E:)
    snamtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvva
    gkyypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddl
    fdeclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmt
    fneinnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfq
    igcmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnldit
    aedlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglr
    yamnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdl
    igytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaei
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzeE (E:)
    mtikgrafpegflwggavaahqleggykeggkglstadimtlreitdgvvagkyypnhqa
    idfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfdeclkngi
    qpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfneinnqtn
    fesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqigcmiamcp
    iypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditaedlkilqa
    gtvdyigfsyymsftvkdtgklayneehdlvknpyvkaqvdpvglryamnwftdryhlpl
    fivenglgaidkktadnqihddyridyltdhlrqiklavledgvdligytpwgcidlvaa
    stgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4gzeF (F:)
    snamtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvva
    gkyypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddl
    fdeclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmt
    fneinnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfq
    igcmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnldit
    aedlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglr
    yamnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdl
    igytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaei
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzeF (F:)
    mtikgrafpegflwggavaahqleggykeggkglstadimtlgtpreitdgvvagkyypn
    hqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfdeclk
    ngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfneinn
    qtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqigcmia
    mcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditaedlki
    lqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkqvdpvglryamnwftdryhl
    plfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdligytpwgcidlv
    aastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie