PDB entry 4gyv

View 4gyv on RCSB PDB site
Description: Crystal strucure of the DH domain of FARP2
Class: signaling protein
Keywords: FARP2, DH, GEF, guanine nucleotide exchange factor, SIGNALING PROTEIN
Deposited on 2012-09-05, released 2013-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.179
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Farp2, Kiaa0793
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VS8 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d4gyva1, d4gyva2
  • Chain 'B':
    Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Farp2, Kiaa0793
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VS8 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d4gyvb1, d4gyvb2
  • Chain 'C':
    Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Farp2, Kiaa0793
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VS8 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d4gyvc1, d4gyvc2
  • Chain 'D':
    Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Farp2, Kiaa0793
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VS8 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d4gyvd1, d4gyvd2
  • Chain 'E':
    Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Farp2, Kiaa0793
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VS8 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d4gyve1, d4gyve2
  • Chain 'F':
    Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Farp2, Kiaa0793
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VS8 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d4gyvf1, d4gyvf2
  • Chain 'G':
    Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Farp2, Kiaa0793
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VS8 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d4gyvg1, d4gyvg2
  • Chain 'H':
    Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Farp2, Kiaa0793
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VS8 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d4gyvh1, d4gyvh2
  • Chain 'I':
    Compound: FERM, RhoGEF and pleckstrin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Farp2, Kiaa0793
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VS8 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d4gyvi1, d4gyvi2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gyvA (A:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gyvA (A:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gyvB (B:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gyvB (B:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gyvC (C:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gyvC (C:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gyvD (D:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gyvD (D:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gyvE (E:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gyvE (E:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4gyvF (F:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gyvF (F:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4gyvG (G:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gyvG (G:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4gyvH (H:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gyvH (H:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4gyvI (I:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdlvgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gyvI (I:)
    gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
    fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
    katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
    chealkaitevttelqqsltrlenlqkltelqrdl