PDB entry 4gyp

View 4gyp on RCSB PDB site
Description: Crystal structure of the heterotetrameric complex of GlucD and GlucDRP from E. coli K-12 MG1655 (EFI TARGET EFI-506058)
Class: lyase/lyase
Keywords: TIM-BARREL, LYASE-LYASE complex, Structural genomics, Enzyme Function Initiative (EFI)
Deposited on 2012-09-05, released 2012-09-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.15
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:83333]
    Gene: b2787, gudD, JW2758, ygcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4gypa1, d4gypa2
  • Chain 'B':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:83333]
    Gene: b2787, gudD, JW2758, ygcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4gypb1, d4gypb2
  • Chain 'C':
    Compound: Glucarate dehydratase-related protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b2788, gudX, JW2759, ygcY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4gypc1, d4gypc2
  • Chain 'D':
    Compound: Glucarate dehydratase-related protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b2788, gudX, JW2759, ygcY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4gypd1, d4gypd2
  • Heterogens: MG, SO4, GOL, PEG, CIT, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gypA (A:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gypA (A:)
    sqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekir
    ktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamld
    llgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheea
    mtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawsl
    neaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtl
    slqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgki
    taidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgar
    ddamgmqylipgwtfdnkrpcmvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gypB (B:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gypB (B:)
    qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk
    tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
    lgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeam
    tpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawsln
    eaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtls
    lqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkit
    aidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgard
    damgmqylipgwtfdnkrpcmvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gypC (C:)
    mghhhhhhhhhhgatqsspvitdmkvipvaghdsmllniggahnayftrnivvltdnagh
    tgigeapggdviyqtlvdaipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelr
    vnavaaleaalldllgkalnvpvcellgpgkqreaitvlgylfyigdrtktdlpyventp
    gnhewyqlrhqkamnseavvrlaeasqdrygfkdfklkggvlpgeqeidtvralkkrfpd
    aritvdpngawlldeaislckglndvltyaedpcgaeqgfsgrevmaefrratglpvatn
    miatnwremghavmlnavdipladphfwtlsgavrvaqlcddwgltwgchsnnhfdisla
    mfthvgaaapgnptaidthwiwqegdcrltqnpleikngkiavpdapglgveldweqvqk
    aheaykrlpggarndagpmqylipgwtfdrkrpvfgrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gypC (C:)
    spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
    daipmvlgqevarlnkvvqqvhkgnqelrvnavaaleaalldllgkalnvpvcellgpgk
    qreaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnseavvrlaeasqdryg
    fkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeaislckglndvltyae
    dpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlnavdipladphfwtls
    gavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaidthwiwqegdcrltq
    npleikngkiavpdapglgveldweqvqkaheaykrlpggarndagpmqylipgwtfdrk
    rpvfgrh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gypD (D:)
    mghhhhhhhhhhgatqsspvitdmkvipvaghdsmllniggahnayftrnivvltdnagh
    tgigeapggdviyqtlvdaipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelr
    vnavaaleaalldllgkalnvpvcellgpgkqreaitvlgylfyigdrtktdlpyventp
    gnhewyqlrhqkamnseavvrlaeasqdrygfkdfklkggvlpgeqeidtvralkkrfpd
    aritvdpngawlldeaislckglndvltyaedpcgaeqgfsgrevmaefrratglpvatn
    miatnwremghavmlnavdipladphfwtlsgavrvaqlcddwgltwgchsnnhfdisla
    mfthvgaaapgnptaidthwiwqegdcrltqnpleikngkiavpdapglgveldweqvqk
    aheaykrlpggarndagpmqylipgwtfdrkrpvfgrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gypD (D:)
    spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
    daipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgk
    alnvpvcellgpgkqreaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnse
    avvrlaeasqdrygfkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeai
    slckglndvltyaedpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlna
    vdipladphfwtlsgavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaid
    thwiwqegdcrltqnpleikngkiavpdapglgveldweqvqkaheaykrlpggarndag
    pmqylipgwtfdrkrpvfgr