PDB entry 4gxv

View 4gxv on RCSB PDB site
Description: Crystal structure of anti-influenza virus antibody 1F1
Class: immune system
Keywords: immunoglobulin, immune recognition, IMMUNE SYSTEM
Deposited on 2012-09-04, released 2012-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.182
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Antibody 1F1, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GXV (0-End)
  • Chain 'I':
    Compound: Antibody 1F1, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GXV (0-End)
  • Chain 'L':
    Compound: Antibody 1F1, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GXV (0-End)
    Domains in SCOPe 2.07: d4gxvl1, d4gxvl2
  • Chain 'M':
    Compound: Antibody 1F1, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GXV (0-End)
    Domains in SCOPe 2.07: d4gxvm1, d4gxvm2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4gxvL (L:)
    epvltqppsasgspgqrvtiscsgsssnigsytvnwyqqlpgtapklliyslnqrpsgvp
    drfsgsksgtsaslaisglqsedeavyycaawddslsahvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxvL (L:)
    epvltqppsasgspgqrvtiscsgsssnigsytvnwyqqlpgtapklliyslnqrpsgvp
    drfsgsksgtsaslaisglqsedeavyycaawddslsahvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4gxvM (M:)
    epvltqppsasgspgqrvtiscsgsssnigsytvnwyqqlpgtapklliyslnqrpsgvp
    drfsgsksgtsaslaisglqsedeavyycaawddslsahvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxvM (M:)
    epvltqppsasgspgqrvtiscsgsssnigsytvnwyqqlpgtapklliyslnqrpsgvp
    drfsgsksgtsaslaisglqsedeavyycaawddslsahvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapt