PDB entry 4gxo

View 4gxo on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus protein SarZ mutant C13E
Class: transcription
Keywords: transcriptional regulator, TRANSCRIPTION
Deposited on 2012-09-04, released 2012-09-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.224
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MarR family regulatory protein
    Species: Staphylococcus aureus [TaxId:426430]
    Gene: NWMN_2286, sarZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJM6 (4-End)
      • expression tag (0-3)
      • engineered mutation (10)
    Domains in SCOPe 2.03: d4gxoa_
  • Chain 'B':
    Compound: MarR family regulatory protein
    Species: Staphylococcus aureus [TaxId:426430]
    Gene: NWMN_2286, sarZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJM6 (4-End)
      • expression tag (0-3)
      • engineered mutation (10)
    Domains in SCOPe 2.03: d4gxob_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gxoA (A:)
    gshmylskqleflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvsknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxoA (A:)
    gshmylskqleflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvskn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gxoB (B:)
    gshmylskqleflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvsknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxoB (B:)
    gshmylskqleflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvs