PDB entry 4gwj

View 4gwj on RCSB PDB site
Description: His 62 mutant of the lectin binding domain of Lectinolysin complexed with Lewis b
Class: sugar binding protein
Keywords: cholesterol-dependent cytolysins, lewis antigens, F-type lectin, glycan binding, SUGAR BINDING PROTEIN
Deposited on 2012-09-03, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Platelet aggregation factor Sm-hPAF
    Species: Streptococcus mitis [TaxId:28037]
    Gene: samhpaf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2PHL4
      • engineered mutation (24)
      • see remark 999 (29)
      • see remark 999 (120)
    Domains in SCOPe 2.07: d4gwja_
  • Heterogens: MG, CA, FUC, GAL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4gwjA (A:)
eqgnrpveteniargkqasqsstahggaatravdgnvdsdyghhsvthtnfednawwqvd
lgktenvgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftak
daryvkvelktkntplslaevevfrsattqvgc

    Sequence, based on observed residues (ATOM records): (download) 
    >4gwjA (A:)
pveteniargkqasqsstahggaatravdgnvdsdyghhsvthtnfednawwqvdlgkte
nvgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftakdaryv
kvelktkntplslaevevfrsa