PDB entry 4gwf

View 4gwf on RCSB PDB site
Description: Crystal structure of the tyrosine phosphatase SHP-2 with Y279C mutation
Class: hydrolase
Keywords: alpha/beta proteins, SH2 domain, phosphatase domain, Tyrosine Phosphatase SHP-2, HYDROLASE
Deposited on 2012-09-03, released 2013-09-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.211
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (299)
    Domains in SCOPe 2.04: d4gwfa1, d4gwfa2, d4gwfa3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (299)
    Domains in SCOPe 2.04: d4gwfb1, d4gwfb2, d4gwfb3
  • Heterogens: EDO, GOL, PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gwfA (A:)
    mgsshhhhhhssgrenlyfqgmtsrrwfhpnitgveaenllltrgvdgsflarpsksnpg
    dftlsvrrngavthikiqntgdyydlyggekfatlaelvqyymehhgqlkekngdvielk
    yplncadptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkge
    sndgkskvthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplntt
    rinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknrc
    knilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntvn
    dfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlr
    elklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhc
    sagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavq
    hyietlqrrieeeqkskrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gwfA (A:)
    tsrrwfhpnitgveaenllltrgvdgsflarpsnpgdftlsvrrngavthikiqntgdyy
    dlyggekfatlaelvqyymegqlkevielkyplncadptserwfhghlsgkeaeklltek
    gkhgsflvresqshpgdfvlsvrtgkskvthvmircqelkydvgggerfdsltdlvehyk
    knpmvetlgtvlqlkqplnttrinaaeiesrvrelskgfweefetlqqqeckllysrkeg
    qrqenknknrcknilpfdhtrvvlhdgdpnepvsdyinaniimpekksyiatqgclqntv
    ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl
    relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
    csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav
    qhyietlqrrieeeqks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gwfB (B:)
    mgsshhhhhhssgrenlyfqgmtsrrwfhpnitgveaenllltrgvdgsflarpsksnpg
    dftlsvrrngavthikiqntgdyydlyggekfatlaelvqyymehhgqlkekngdvielk
    yplncadptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkge
    sndgkskvthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplntt
    rinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknrc
    knilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntvn
    dfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlr
    elklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhc
    sagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavq
    hyietlqrrieeeqkskrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gwfB (B:)
    srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
    ydlyggekfatlaelvqyymehhgqlvielkyplncadptserwfhghlsgkeaekllte
    kgkhgsflvresqshpgdfvlsvrtgkvthvmircqelkydvgggerfdsltdlvehykk
    npmvetlgtvlqlkqplnttrinaaeiesrvrelskgfweefetlqqqeckllysrkegq
    rqenknknrcknilpfdhtrvvlhdgdpnepvsdyinaniimpksyiatqgclqntvndf
    wrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrel
    klskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsa
    gigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhy
    ietlqrrieeeqk