PDB entry 4gwc

View 4gwc on RCSB PDB site
Description: Crystal Structure of Mn2+2,Zn2+-Human Arginase I
Class: hydrolase
Keywords: arginase fold, hydrolase
Deposited on 2012-09-01, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.154
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gwca_
  • Chain 'B':
    Compound: Arginase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gwcb_
  • Heterogens: MN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gwcA (A:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gwcA (A:)
    srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
    qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
    ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
    gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
    gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
    glaregnhkpidy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gwcB (B:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gwcB (B:)
    srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
    qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
    ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
    gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
    gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
    glaregnhkpidy