PDB entry 4gw4

View 4gw4 on RCSB PDB site
Description: Crystal structure of 3BNC60 Fab with P61A mutation
Class: immune system
Keywords: FWR, IgG, Anti HIV, gp120, HIV, IMMUNE SYSTEM
Deposited on 2012-08-31, released 2013-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3BNC60 Fab Heavy-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GW4
  • Chain 'B':
    Compound: 3BNC60 Fab Light-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GW4
    Domains in SCOPe 2.07: d4gw4b1, d4gw4b2
  • Chain 'H':
    Compound: 3BNC60 Fab Heavy-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GW4 (0-End)
  • Chain 'L':
    Compound: 3BNC60 Fab Light-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GW4
    Domains in SCOPe 2.07: d4gw4l1, d4gw4l2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gw4B (B:)
    diqmtqspsslsarvgdtvtitcqangylnwyqqrrgkapklliydgsklergvparfsg
    rrwgqeynltinnlqpedvatyfcqvyefivpgtrldlkrtvaapsvfifppsdeqlksg
    tasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyek
    hkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gw4B (B:)
    mtqspsslsarvgdtvtitcqangylnwyqqrrgkapklliydgsklergvparfsgrrw
    gqeynltinnlqpedvatyfcqvyefivpgtrldlkrtvaapsvfifppsdeqlksgtas
    vvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkv
    yacevthqglsspvtksfn
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4gw4L (L:)
    diqmtqspsslsarvgdtvtitcqangylnwyqqrrgkapklliydgsklergvparfsg
    rrwgqeynltinnlqpedvatyfcqvyefivpgtrldlkrtvaapsvfifppsdeqlksg
    tasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyek
    hkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gw4L (L:)
    mtqspsslsarvgdtvtitcqangylnwyqqrrgkapklliydgsklergvparfsgrrw
    gqeynltinnlqpedvatyfcqvyefivpgtrldlkrtvaapsvfifppsdeqlksgtas
    vvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkv
    yacevthqglsspvtksf