PDB entry 4gvi

View 4gvi on RCSB PDB site
Description: Crystal structure of mutant (D248N) Salmonella typhimurium family 3 glycoside hydrolase (NagZ) in complex with GlcNAc-1,6-anhMurNAc
Class: hydrolase
Keywords: tim-barrel, hydrolase
Deposited on 2012-08-30, released 2012-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.172
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hexosaminidase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: nagZ, STM1209
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZQ06 (0-End)
      • engineered mutation (247)
    Domains in SCOPe 2.06: d4gvia_
  • Chain 'B':
    Compound: Beta-hexosaminidase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: nagZ, STM1209
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZQ06 (0-End)
      • engineered mutation (247)
    Domains in SCOPe 2.06: d4gvib_
  • Heterogens: NAG, AH0, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gviA (A:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
    cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
    fdgvifsndlsmegaaimgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaerv
    trlyhkgsfsrrelmdsarwktasaqlnqlherwqeekaghgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gviA (A:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
    cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
    fdgvifsndlsmsyaeraqasldagcdmilvcnnrkgavsvldnlspikaervtrlyhkg
    sfsrrelmdsarwktasaqlnqlherwqeekag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gviB (B:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
    cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
    fdgvifsndlsmegaaimgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaerv
    trlyhkgsfsrrelmdsarwktasaqlnqlherwqeekaghgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gviB (B:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavthketpcdp
    rpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelgfdg
    vifsndlsmgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaervtrlyhkgsf
    srrelmdsarwktasaqlnqlherwqeekag