PDB entry 4gvf

View 4gvf on RCSB PDB site
Description: Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc
Class: hydrolase
Keywords: tim-barrel, hydrolase
Deposited on 2012-08-30, released 2012-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.168
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hexosaminidase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: nagZ, STM1209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gvfa_
  • Chain 'B':
    Compound: Beta-hexosaminidase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: nagZ, STM1209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gvfb_
  • Heterogens: NDG, NAG, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gvfA (A:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
    cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
    fdgvifsddlsmegaaimgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaerv
    trlyhkgsfsrrelmdsarwktasaqlnqlherwqeekaghgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gvfA (A:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
    cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
    fdgvifsddlsmegaaimgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaerv
    trlyhkgsfsrrelmdsarwktasaqlnqlherwqeekag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gvfB (B:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
    cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
    fdgvifsddlsmegaaimgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaerv
    trlyhkgsfsrrelmdsarwktasaqlnqlherwqeekaghgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gvfB (B:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtetpcdprp
    etdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelgfdgvi
    fsddlssyaeraqasldagcdmilvcnnrkgavsvldnlspikaervtrlyhkgsfsrre
    lmdsarwktasaqlnqlherwqeekagh