PDB entry 4gv4

View 4gv4 on RCSB PDB site
Description: Human ARTD3 (PARP3) - Catalytic domain in complex with inhibitor ME0328
Class: transferase/transferase inhibitor
Keywords: nad, ADP-ribose, parp3, artd3, artd transferase domain, ADP- ribosylation, transferase-transferase inhibitor complex, transferase, ADP-ribosylation
Deposited on 2012-08-30, released 2013-06-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6F1 (2-356)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4gv4a1, d4gv4a2
  • Heterogens: MEJ, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gv4A (A:)
    smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
    leealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladiela
    qalqavseqektveevphpldrdyqllkcqlqlldsgapeykviqtyleqtgsnhrcptl
    qhiwkvnqegeedrfqahsklgnrkllwhgtnmavvaailtsglrimphsggrvgkgiyf
    asensksagyvigmkcgahhvgymflgevalgrehhintdnpslkspppgfdsviarght
    epdptqdteleldgqqvvvpqgqpvpcpefssstfsqseyliyqesqcrlryllevh