PDB entry 4gt7

View 4gt7 on RCSB PDB site
Description: An engineered disulfide bond reversibly traps the IgE-Fc3-4 in a closed, non-receptor binding conformation
Class: Immune system
Keywords: Immunoglobulin, antibody, IgE, Fc fragment, Immune system, Fc receptor
Deposited on 2012-08-28, released 2012-09-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.192
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854 (Start-220)
      • engineered mutation (10)
    Domains in SCOPe 2.04: d4gt7a1, d4gt7a2
  • Chain 'B':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854 (Start-220)
      • engineered mutation (10)
    Domains in SCOPe 2.04: d4gt7b1, d4gt7b2
  • Chain 'C':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854 (Start-220)
      • engineered mutation (10)
    Domains in SCOPe 2.04: d4gt7c1, d4gt7c2
  • Chain 'D':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854 (Start-220)
      • engineered mutation (10)
    Domains in SCOPe 2.04: d4gt7d1, d4gt7d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gt7A (A:)
    adpaadsnprcvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnh
    strkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraape
    vyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgff
    vfsrlevtraeweqkdeficravheaaspsqtvqravsvnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gt7A (A:)
    rcvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeekqr
    ngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpew
    pgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtr
    aeweqkdeficravheaaspsqtvqravsvnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gt7B (B:)
    adpaadsnprcvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnh
    strkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraape
    vyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgff
    vfsrlevtraeweqkdeficravheaaspsqtvqravsvnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gt7B (B:)
    prcvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeekq
    rngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpe
    wpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevt
    raeweqkdeficravheaaspsqtvqravsvnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gt7C (C:)
    adpaadsnprcvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnh
    strkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraape
    vyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgff
    vfsrlevtraeweqkdeficravheaaspsqtvqravsvnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gt7C (C:)
    nprcvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeek
    qrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatp
    ewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlev
    traeweqkdeficravheaaspsqtvqravsvnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gt7D (D:)
    adpaadsnprcvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnh
    strkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraape
    vyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgff
    vfsrlevtraeweqkdeficravheaaspsqtvqravsvnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gt7D (D:)
    prcvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeekq
    rngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpe
    wpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevt
    raeweqkdeficravheaaspsqtvqravsvnp