PDB entry 4gt1

View 4gt1 on RCSB PDB site
Description: Crystal structure of a MeaB- and MMAA-like GTPase from Mycobacterium tuberculosis bound to 2'-deoxyguanosine diphosphate
Class: hydrolase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Mycobacterium, GTPase, ATPase, substrate-specificity, hydrolase, G-protein, Ras-like GTPase, ArgK superfamily, chain swapped homodimer
Deposited on 2012-08-28, released 2012-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable GTPase Rv1496/MT1543
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT1543, MTCY277.18, Rv1496
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gt1a_
  • Heterogens: DGI, PGE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gt1A (A:)
    mahhhhhhmgtleaqtqgpgsmmaashdddtvdglatavrggdraalpraitlvestrpd
    hreqaqqlllrllpdsgnahrvgitgvpgvgkstaiealgmhlierghrvavlavdpsst
    rtggsilgdktrmarlavhpnayirpsptsgtlggvtratretvvlleaagfdvilietv
    gvgqsevavanmvdtfvlltlartgdqlqgikkgvleladivvvnkadgehhkearlaar
    elsaairliyprealwrppvltmsavegrglaelwdtverhrqvltgagefdarrrdqqv
    dwtwqlvrdavldrvwsnptvrkvrselerrvrageltpalaaqqileianltdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gt1A (A:)
    tvdglatavrggdraalpraitlvestrpdhreqaqqlllrllpdsgnahrvgitgvpgv
    gkstaiealgmhlierghrvavlavdmarlavhpnayirtlggvtratretvvlleaagf
    dvilietvgvgqsevavanmvdtfvlltlartgdqlqgikkgvleladivvvnkadgehh
    kearlaarelsaairliyprealwrppvltmsavegrglaelwdtverhrqvltgagefd
    arrrdqqvdwtwqlvrdavldrvwsnptvrkvrselerrvrageltpalaaqqileianl
    td