PDB entry 4gt0

View 4gt0 on RCSB PDB site
Description: Structure of dengue virus serotype 1 sE containing stem to residue 421
Class: viral protein
Keywords: Viral fusion protein, VIRAL PROTEIN
Deposited on 2012-08-28, released 2012-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.183
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Dengue virus 1 [TaxId:11059]
    Gene: Envelope protein
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17763
      • engineered mutation (116)
      • conflict (176)
      • conflict (217-218)
    Domains in SCOPe 2.06: d4gt0a1, d4gt0a2
  • Chain 'B':
    Compound: Envelope protein E
    Species: Dengue virus 1 [TaxId:11059]
    Gene: Envelope protein
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17763
      • conflict (176)
      • conflict (217-218)
    Domains in SCOPe 2.06: d4gt0b1, d4gt0b2
  • Heterogens: NAG, CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gt0A (A:)
    ghhhhhhhhgsstsngmrcvgignrdfveglsgatwvdvvlehgscvttmakdkptldie
    llktevtnpavlrklcieakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrghgng
    cglfgkgslitcakfkcvtklegkivqyenlkysvivtvhtgdqhqvgnettehgtiati
    tpqaptseiqltdygaltldcsprtgldfnemvlltmkekswlvhkqwfldlplpwtsga
    stsqetwnrqdllvtfktahakkqevvvlgsqegamhtaltgateiqtsgtttifaghlk
    crlkmdkltlkgmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekg
    vtqngrlitanpivtdkekpvnieaeppfgesyivvgagekalklswfkkgssigkmfea
    targarrmailgdtawd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gt0A (A:)
    rcvgignrdfveglsgatwvdvvlehgscvttmakdkptldiellktevtnpavlrklci
    eakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrghgngcglfgkgslitcakfkc
    vtklegkivqyenlkysvivtvhtggtiatitpqaptseiqltdygaltldcsprtgldf
    nemvlltmkekswlvhkqwfldlplpwtsgastsqetwnrqdllvtfktahakkqevvvl
    gsqegamhtaltgateiqtsgtttifaghlkcrlkmdkltlkgmsyvmctgsfklekeva
    etqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpivtdkekpvnieaeppf
    gesyivvgagekalklswfkkgssigkmfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gt0B (B:)
    ghhhhhhhhgsstsngmrcvgignrdfveglsgatwvdvvlehgscvttmakdkptldie
    llktevtnpavlrklcieakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrghgng
    cglfgkgslitcakfkcvtklegkivqyenlkysvivtvhtgdqhqvgnettehgtiati
    tpqaptseiqltdygaltldcsprtgldfnemvlltmkekswlvhkqwfldlplpwtsga
    stsqetwnrqdllvtfktahakkqevvvlgsqegamhtaltgateiqtsgtttifaghlk
    crlkmdkltlkgmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekg
    vtqngrlitanpivtdkekpvnieaeppfgesyivvgagekalklswfkkgssigkmfea
    targarrmailgdtawd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gt0B (B:)
    rcvgignrdfveglsgatwvdvvlehgscvttmakdkptldiellktevtnpavlrklci
    eakisntttdsrcptqgeatlveeqdtnfvcrrtfvdrggngcglfgkgslitcakfkcv
    tklegkivqyenlkysvivtvhthgtiatitpqaptseiqltdygaltldcsprtgldfn
    emvlltmkekswlvhkqwfldlplpwtsgastsqetwnrqdllvtfktahakkqevvvlg
    sqegamhtaltgateiqtsgtttifaghlkcrlkmdkltlkgmsyvmctgsfklekevae
    tqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpivtdkekpvnieaeppfg
    esyivvgagekalklswfkkgssigkmfea