PDB entry 4gsv

View 4gsv on RCSB PDB site
Description: Crystal Structure of the Ni2+2-Human Arginase I-ABH complex
Class: hydrolase/hydrolase inhibitor
Keywords: ARGINASE FOLD, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-08-28, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.153
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gsva_
  • Chain 'B':
    Compound: Arginase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gsvb_
  • Heterogens: NI, ABH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gsvA (A:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gsvA (A:)
    rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
    ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
    htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
    ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
    tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
    laregnhkpidyln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gsvB (B:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gsvB (B:)
    rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
    ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
    htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
    ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
    tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
    laregnhkpidyln