PDB entry 4gss

View 4gss on RCSB PDB site
Description:
Deposited on 1997-01-20, released 1998-01-28
The last revision prior to the SCOP 1.69 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d4gssa1, d4gssa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d4gssb1, d4gssb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gssA (A:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliftnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gssA (A:)
    pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
    lyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliftnyeagkddyvka
    lpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayvg
    rlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gssB (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliftnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gssB (B:)
    pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
    lyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliftnyeagkddyvka
    lpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayvg
    rlsarpklkaflaspeyvnlpingngkq