PDB entry 4gss

View 4gss on RCSB PDB site
Description: human glutathione s-transferase p1-1 y108f mutant
Deposited on 1997-01-20, released 1998-01-28
The last revision prior to the SCOP 1.61 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gssA (A:)
    pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
    lyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliftnyeagkddyvka
    lpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayvg
    rlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gssB (B:)
    pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
    lyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliftnyeagkddyvka
    lpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayvg
    rlsarpklkaflaspeyvnlpingngkq