PDB entry 4gsd

View 4gsd on RCSB PDB site
Description: H5.3 Fab Structure
Class: immune system
Keywords: antibody, immune response, influenza H5 Hemagglutanin, IMMUNE SYSTEM
Deposited on 2012-08-27, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.174
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: H5.3 Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GSD
  • Chain 'L':
    Compound: H5.3 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GSD
    Domains in SCOPe 2.07: d4gsdl1, d4gsdl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4gsdL (L:)
    syeltqppsvsvspgqtvnitcsgdtlgdkyvcwyqqkpgqspvlviyqdtkrpsgiper
    fsgsnsgdtatltvsgtqamdeadyycqawdsssfvfgtgtkvtvlrqpkanptvtlfpp
    sseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gsdL (L:)
    ltqppsvsvspgqtvnitcsgdtlgdkyvcwyqqkpgqspvlviyqdtkrpsgiperfsg
    snsgdtatltvsgtqamdeadyycqawdsssfvfgtgtkvtvlrqpkanptvtlfppsse
    elqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassylsltpe
    qwkshrsyscqvthegstvektvapte