PDB entry 4grx

View 4grx on RCSB PDB site
Description: Structure of an omega-aminotransferase from Paracoccus denitrificans
Class: transferase
Keywords: class III transaminase, TRANSFERASE
Deposited on 2012-08-27, released 2012-12-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.181
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_3984
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4grxa_
  • Chain 'B':
    Compound: aminotransferase
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_3984
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4grxb_
  • Chain 'C':
    Compound: aminotransferase
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_3984
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4grxc_
  • Chain 'D':
    Compound: aminotransferase
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_3984
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4grxd_
  • Heterogens: NA, DAV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4grxA (A:)
    maswshpqfekganqpqswearaetyslygftdmpsvhqrgtvvvthgegpyivdvhgrr
    yldansglwnmvagfdhkglieaakaqydrfpgyhaffgrmsdqtvmlseklvevspfdn
    grvfytnsgseandtmvkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpynsv
    fglplpgfihltcphywrygeegeteaqfvarlareledtitregadtiagffaepvmga
    ggvippakgyfqailpilrkydipmisdevicgfgrtgntwgcltydfmpdaiissknlt
    agffpmgavilgpdlakrveaaveaieefphgftasghpvgcaialkaidvvmneglaen
    vrrlaprfeaglkriadrpnigeyrgigfmwaleavkdkptktpfdanlsvseriantct
    dlglicrplgqsivlcppfilteaqmdemfeklekaldkvfaeva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grxA (A:)
    qswearaetyslygftdmpsvhqrgtvvvthgegpyivdvhgrryldansglwnmvagfd
    hkglieaakaqydrfpgyhaffgrmsdqtvmlseklvevspfdngrvfytnsgseandtm
    vkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpynsvfglplpgfihltcphy
    wrygeegeteaqfvarlareledtitregadtiagffaepvmgaggvippakgyfqailp
    ilrkydipmisdevicgfgrtgntwgcltydfmpdaiissknltagffpmgavilgpdla
    krveaaveaieefphgftasghpvgcaialkaidvvmneglaenvrrlaprfeaglkria
    drpnigeyrgigfmwaleavkdkptktpfdanlsvseriantctdlglicrplgqsivlc
    ppfilteaqmdemfeklekaldkvfaeva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4grxB (B:)
    maswshpqfekganqpqswearaetyslygftdmpsvhqrgtvvvthgegpyivdvhgrr
    yldansglwnmvagfdhkglieaakaqydrfpgyhaffgrmsdqtvmlseklvevspfdn
    grvfytnsgseandtmvkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpynsv
    fglplpgfihltcphywrygeegeteaqfvarlareledtitregadtiagffaepvmga
    ggvippakgyfqailpilrkydipmisdevicgfgrtgntwgcltydfmpdaiissknlt
    agffpmgavilgpdlakrveaaveaieefphgftasghpvgcaialkaidvvmneglaen
    vrrlaprfeaglkriadrpnigeyrgigfmwaleavkdkptktpfdanlsvseriantct
    dlglicrplgqsivlcppfilteaqmdemfeklekaldkvfaeva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grxB (B:)
    qswearaetyslygftdmpsvhqrgtvvvthgegpyivdvhgrryldansglwnmvagfd
    hkglieaakaqydrfpgyhaffgrmsdqtvmlseklvevspfdngrvfytnsgseandtm
    vkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpynsvfglplpgfihltcphy
    wrygeegeteaqfvarlareledtitregadtiagffaepvmgaggvippakgyfqailp
    ilrkydipmisdevicgfgrtgntwgcltydfmpdaiissknltagffpmgavilgpdla
    krveaaveaieefphgftasghpvgcaialkaidvvmneglaenvrrlaprfeaglkria
    drpnigeyrgigfmwaleavkdkptktpfdanlsvseriantctdlglicrplgqsivlc
    ppfilteaqmdemfeklekaldkvfaeva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4grxC (C:)
    maswshpqfekganqpqswearaetyslygftdmpsvhqrgtvvvthgegpyivdvhgrr
    yldansglwnmvagfdhkglieaakaqydrfpgyhaffgrmsdqtvmlseklvevspfdn
    grvfytnsgseandtmvkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpynsv
    fglplpgfihltcphywrygeegeteaqfvarlareledtitregadtiagffaepvmga
    ggvippakgyfqailpilrkydipmisdevicgfgrtgntwgcltydfmpdaiissknlt
    agffpmgavilgpdlakrveaaveaieefphgftasghpvgcaialkaidvvmneglaen
    vrrlaprfeaglkriadrpnigeyrgigfmwaleavkdkptktpfdanlsvseriantct
    dlglicrplgqsivlcppfilteaqmdemfeklekaldkvfaeva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grxC (C:)
    qswearaetyslygftdmpsvhqrgtvvvthgegpyivdvhgrryldansglwnmvagfd
    hkglieaakaqydrfpgyhaffgrmsdqtvmlseklvevspfdngrvfytnsgseandtm
    vkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpynsvfglplpgfihltcphy
    wrygeegeteaqfvarlareledtitregadtiagffaepvmgaggvippakgyfqailp
    ilrkydipmisdevicgfgrtgntwgcltydfmpdaiissknltagffpmgavilgpdla
    krveaaveaieefphgftasghpvgcaialkaidvvmneglaenvrrlaprfeaglkria
    drpnigeyrgigfmwaleavkdkptktpfdanlsvseriantctdlglicrplgqsivlc
    ppfilteaqmdemfeklekaldkvfaeva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4grxD (D:)
    maswshpqfekganqpqswearaetyslygftdmpsvhqrgtvvvthgegpyivdvhgrr
    yldansglwnmvagfdhkglieaakaqydrfpgyhaffgrmsdqtvmlseklvevspfdn
    grvfytnsgseandtmvkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpynsv
    fglplpgfihltcphywrygeegeteaqfvarlareledtitregadtiagffaepvmga
    ggvippakgyfqailpilrkydipmisdevicgfgrtgntwgcltydfmpdaiissknlt
    agffpmgavilgpdlakrveaaveaieefphgftasghpvgcaialkaidvvmneglaen
    vrrlaprfeaglkriadrpnigeyrgigfmwaleavkdkptktpfdanlsvseriantct
    dlglicrplgqsivlcppfilteaqmdemfeklekaldkvfaeva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grxD (D:)
    qswearaetyslygftdmpsvhqrgtvvvthgegpyivdvhgrryldansglwnmvagfd
    hkglieaakaqydrfpgyhaffgrmsdqtvmlseklvevspfdngrvfytnsgseandtm
    vkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpynsvfglplpgfihltcphy
    wrygeegeteaqfvarlareledtitregadtiagffaepvmgaggvippakgyfqailp
    ilrkydipmisdevicgfgrtgntwgcltydfmpdaiissknltagffpmgavilgpdla
    krveaaveaieefphgftasghpvgcaialkaidvvmneglaenvrrlaprfeaglkria
    drpnigeyrgigfmwaleavkdkptktpfdanlsvseriantctdlglicrplgqsivlc
    ppfilteaqmdemfeklekaldkvfaeva