PDB entry 4grm

View 4grm on RCSB PDB site
Description: The crystal structure of the high affinity TCR A6
Class: immune system
Keywords: high-affinity TCR, c134 modification, TAX peptide, nonapeptide, MHC class I, HLA-A2, TCR A6, cross-reactivity, IMMUNE SYSTEM
Deposited on 2012-08-25, released 2013-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A6 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GRM
    Domains in SCOPe 2.07: d4grma1, d4grma2
  • Chain 'B':
    Compound: A6 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GRM (Start-244)
    Domains in SCOPe 2.07: d4grmb1, d4grmb2
  • Chain 'C':
    Compound: A6 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GRM (0-End)
    Domains in SCOPe 2.07: d4grmc1, d4grmc2
  • Chain 'D':
    Compound: A6 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GRM (0-End)
    Domains in SCOPe 2.07: d4grmd1, d4grmd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4grmA (A:)
    keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
    taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpdiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grmA (A:)
    eveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrft
    aqlnkasqyvsllirdsqpsdsatylcavttgklqfgagtqvvvtpdiqnpdpavyqlrd
    skssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfaca
    nafn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4grmB (B:)
    nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
    pngynvsrsttedfplrllsaapsqtsvyfcasrpglmsaqpeqyfgpgtrltvtedlkn
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grmB (B:)
    gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
    gynvsrsttedfplrllsaapsqtsvyfcasrpglqpeqyfgpgtrltvtedlknvfppe
    vavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpaln
    dsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4grmC (C:)
    keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
    taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpdiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grmC (C:)
    keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
    taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpdiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4grmD (D:)
    nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
    pngynvsrsttedfplrllsaapsqtsvyfcasrpglmsaqpeqyfgpgtrltvtedlkn
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grmD (D:)
    nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
    pngynvsrsttedfplrllsaapsqtsvyfcasrpgmsaqpeqyfgpgtrltvtedlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    gra