PDB entry 4grl

View 4grl on RCSB PDB site
Description: Crystal structure of a autoimmune TCR-MHC complex
Class: immune system
Keywords: immune complex, peptide antigen presentation, multiple sclerosis, autoimmunity, IMMUNE SYSTEM
Deposited on 2012-08-25, released 2013-11-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.204
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: alpha chain, HLA-DQ1, HLA-DQA1, MHC CLASS II MOLECULE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4grla1, d4grla2
  • Chain 'B':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: beta chain, HLA-DQ1, HLA-DQB1, MHC CLASS II MOLECULE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4grlb1, d4grlb2
  • Chain 'C':
    Compound: TCR Hy.1B11 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: TCR Hy.1B11 alpha chain
    Database cross-references and differences (RAF-indexed):
    • PDB 4GRL
    Domains in SCOPe 2.04: d4grlc1, d4grlc2
  • Chain 'D':
    Compound: TCR Hy.1B11 beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: TCR Hy.1B11 beta chain
    Database cross-references and differences (RAF-indexed):
    • PDB 4GRL
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4grlA (A:)
    divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg
    alrnmavakhnlnimikrynstaatnevpevtvfskspvtlgqpntliclvdnifppvvn
    itwlsngqsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldqpllkhw
    epe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grlA (A:)
    divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg
    alrnmavakhnlnimikrynstaatnevpevtvfskspvtlgqpntliclvdnifppvvn
    itwlsngqsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldqpllkhw
    ep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4grlB (B:)
    egrdspedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyravtpqgrpva
    eywnsqkevlegarasvdrvcrhnyevayrgilqrrveptvtispsrtealnhhnllics
    vtdfypsqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehp
    slqspitvewraqsesaqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grlB (B:)
    spedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyravtpqgrpvaeywn
    sqkevlegarasvdrvcrhnyevayrgilqrrveptvtispsnllicsvtdfypsqikvr
    wfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewra
    q
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4grlC (C:)
    mkgenveqhpstlsvqegdsavikctysdsasnyfpwykqelgkrpqliidirsnvgekk
    dqriavtlnktakhfslhitetqpedsavyfcaassfgnekltfgtgtrltiipniqnpd
    pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
    nksdfacanafnnsiipedtffpspesss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4grlC (C:)
    enveqhpstlsvqegdsavikctysdsasnyfpwykqelgkrpqliidirsnvgekkdqr
    iavtlnktakhfslhitetqpedsavyfcaassfgnekltfgtgtrltiipniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnns
    

  • Chain 'D':
    No sequence available.