PDB entry 4gqt

View 4gqt on RCSB PDB site
Description: N-terminal domain of C. elegans Hsp90
Class: chaperone
Keywords: structural genomics, APC102132, Hsp90, chaperone, ADP, PSI-Biology, Midwest Center for Structural Genomics, MCSG
Deposited on 2012-08-23, released 2012-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock protein 90
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: C47E8.5, daf-21
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gqta_
  • Chain 'B':
    Compound: heat shock protein 90
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: C47E8.5, daf-21
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gqtb_
  • Heterogens: ADP, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gqtA (A:)
    snamsenaetfafqaeiaqlmsliintfysnkeiylrelisnasdaldkiryqaltepse
    ldtgkelfikitpnkeektltimdtgigmtkadlvnnlgtiaksgtkafmealqagadis
    migqfgvgfysaflvadkvvvtsknndddsyqwessaggsfvvrpfndpevtrgtkivmh
    ikedqidfleerkikeivkkhsqfigypiklvvekerekevedeeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gqtA (A:)
    enaetfafqaeiaqlmsliintfysnkeiylrelisnasdaldkiryqaltepseldtgk
    elfikitpnkeektltimdtgigmtkadlvnnlgtiaksgtkafmealqagadismigqf
    gvgfysaflvadkvvvtsknndddsyqwessaggsfvvrpfndpevtrgtkivmhikedq
    idfleerkikeivkkhsqfigypiklvve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gqtB (B:)
    snamsenaetfafqaeiaqlmsliintfysnkeiylrelisnasdaldkiryqaltepse
    ldtgkelfikitpnkeektltimdtgigmtkadlvnnlgtiaksgtkafmealqagadis
    migqfgvgfysaflvadkvvvtsknndddsyqwessaggsfvvrpfndpevtrgtkivmh
    ikedqidfleerkikeivkkhsqfigypiklvvekerekevedeeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gqtB (B:)
    enaetfafqaeiaqlmsliintfysnkeiylrelisnasdaldkiryqaltepseldtgk
    elfikitpnkeektltimdtgigmtkadlvnnlgtiaksgtkafmealqagadismigqf
    gvgfysaflvadkvvvtsknndddsyqwessaggsfvvrpfndpevtrgtkivmhikedq
    idfleerkikeivkkhsqfigypiklvve