PDB entry 4gqs

View 4gqs on RCSB PDB site
Description: Structure of Human Microsomal Cytochrome P450 (CYP) 2C19
Class: oxidoreductase
Keywords: monooxygenase, drug metabolizing enzyme, oxidoreductase, heme protein
Deposited on 2012-08-23, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.25
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2C19
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2C19
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33261 (Start-471)
      • expression tag (472-474)
    Domains in SCOPe 2.07: d4gqsa1, d4gqsa2
  • Chain 'B':
    Compound: Cytochrome P450 2C19
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2C19
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33261 (Start-471)
      • expression tag (472)
    Domains in SCOPe 2.07: d4gqsb1, d4gqsb2
  • Chain 'C':
    Compound: Cytochrome P450 2C19
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2C19
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33261 (Start-471)
      • expression tag (472)
    Domains in SCOPe 2.07: d4gqsc1, d4gqsc2
  • Chain 'D':
    Compound: Cytochrome P450 2C19
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2C19
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33261 (Start-471)
      • expression tag (472)
    Domains in SCOPe 2.07: d4gqsd1, d4gqsd2
  • Heterogens: HEM, 0XV, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gqsA (A:)
    makktssgrgklppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvl
    hgyevvkealidlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmg
    krsiedrvqeearclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnl
    meklnenirivstpwiqicnnfptiidyfpgthnkllknlafmesdilekvkehqesmdi
    nnprdfidcflikmekekqnqqseftienlvitaadllgagtettsttlryalllllkhp
    evtakvqeeiervvgrnrspcmqdrghmpytdavvhevqryidliptslphavtcdvkfr
    nylipkgttiltsltsvlhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvg
    eglarmelflfltfilqnfnlkslidpkdldttpvvngfasvppfyqlcfipihhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gqsA (A:)
    lppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvlhgyevvkeali
    dlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmgkrsiedrvqee
    arclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnlmeklneniriv
    stpwiqicnnfptiidyfpgthnkllknlafmesdilekvkehqesmdinnprdfidcfl
    ikmekekqnqqseftienlvitaadllgagtettsttlryalllllkhpevtakvqeeie
    rvvgrnrspcmqdrghmpytdavvhevqryidliptslphavtcdvkfrnylipkgttil
    tsltsvlhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvgeglarmelflf
    ltfilqnfnlkslidpkdldttpvvngfasvppfyqlcfipihh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gqsB (B:)
    makktssgrgklppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvl
    hgyevvkealidlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmg
    krsiedrvqeearclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnl
    meklnenirivstpwiqicnnfptiidyfpgthnkllknlafmesdilekvkehqesmdi
    nnprdfidcflikmekekqnqqseftienlvitaadllgagtettsttlryalllllkhp
    evtakvqeeiervvgrnrspcmqdrghmpytdavvhevqryidliptslphavtcdvkfr
    nylipkgttiltsltsvlhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvg
    eglarmelflfltfilqnfnlkslidpkdldttpvvngfasvppfyqlcfipihhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gqsB (B:)
    lppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvlhgyevvkeali
    dlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmgkrsiedrvqee
    arclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnlmeklneniriv
    stpwiqicnnyfpgthnkllknlafmesdilekvkehqesmdinnprdfidcflikmeke
    kqnqqseftienlvitaadllgagtettsttlryalllllkhpevtakvqeeiervvgrn
    rspcmqdrghmpytdavvhevqryidliptslphavtcdvkfrnylipkgttiltsltsv
    lhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvgeglarmelflfltfilq
    nfnlkslidpkdldttpvvngfasvppfyqlcfipi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gqsC (C:)
    makktssgrgklppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvl
    hgyevvkealidlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmg
    krsiedrvqeearclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnl
    meklnenirivstpwiqicnnfptiidyfpgthnkllknlafmesdilekvkehqesmdi
    nnprdfidcflikmekekqnqqseftienlvitaadllgagtettsttlryalllllkhp
    evtakvqeeiervvgrnrspcmqdrghmpytdavvhevqryidliptslphavtcdvkfr
    nylipkgttiltsltsvlhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvg
    eglarmelflfltfilqnfnlkslidpkdldttpvvngfasvppfyqlcfipihhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gqsC (C:)
    lppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvlhgyevvkeali
    dlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmgkrsiedrvqee
    arclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnlmeklneniriv
    stpwiqicnnfptiidyfpgthnkllknlafmesdilekvkehqesmdinnprdfidcfl
    ikmekekqnqqseftienlvitaadllgagtettsttlryalllllkhpevtakvqeeie
    rvvgrnrspcmqdrghmpytdavvhevqryidliptslphavtcdvkfrnylipkgttil
    tsltsvlhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvgeglarmelflf
    ltfilqnfnlkslidpkdldttpvvngfasvppfyqlcfipi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gqsD (D:)
    makktssgrgklppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvl
    hgyevvkealidlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmg
    krsiedrvqeearclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnl
    meklnenirivstpwiqicnnfptiidyfpgthnkllknlafmesdilekvkehqesmdi
    nnprdfidcflikmekekqnqqseftienlvitaadllgagtettsttlryalllllkhp
    evtakvqeeiervvgrnrspcmqdrghmpytdavvhevqryidliptslphavtcdvkfr
    nylipkgttiltsltsvlhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvg
    eglarmelflfltfilqnfnlkslidpkdldttpvvngfasvppfyqlcfipihhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gqsD (D:)
    lppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvlhgyevvkeali
    dlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtledrvqeearclveelrk
    tkaspcdptfilgcapcnvicsiifqkrfdykdqqflnlmeklnenirivstpwiqicnn
    fptiidyfpgthnkllknlafmesdilekvkehqesmdinnprdfidcflikmekekqnq
    qseftienlvitaadllgagtettsttlryalllllkhpevtakvqeeiervvgrnrspc
    mqdrghmpytdavvhevqryidliptslphavtcdvkfrnylipkgttiltsltsvlhdn
    kefpnpemfdprhfldeggnfkksnyfmpfsagkricvgeglarmelflfltfilqnfnl
    kslidpkdldttpvvngfasvppfyqlcfipi