PDB entry 4gq9

View 4gq9 on RCSB PDB site
Description: Chikungunya virus neutralizing antibody 9.8B Fab fragment
Class: viral protein
Keywords: IgG fold, antibody, VIRAL PROTEIN
Deposited on 2012-08-22, released 2013-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.325
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Chikungunya virus neutralizing antibody 9.8B Fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GQ9 (0-217)
  • Chain 'L':
    Compound: Chikungunya virus neutralizing antibody 9.8B Fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GQ9 (0-211)
    Domains in SCOPe 2.07: d4gq9l1, d4gq9l2

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gq9L (L:)
    qivltqspaimsaspgekvtmtcsasssvtymywyqqkpgssprlliydtsnlasgvpvr
    fsgsgsgtsysltisrmeaedaatyycqqrtnypltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne