PDB entry 4gpi

View 4gpi on RCSB PDB site
Description: Crystal structure of human B type phosphoglycerate mutase
Class: Isomerase, hydrolase
Keywords: alpha/beta, Isomerase, hydrolase
Deposited on 2012-08-21, released 2013-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM1, PGAMA, CDABP0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gpib_
  • Chain 'C':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM1, PGAMA, CDABP0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gpic_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gpiB (B:)
    maayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvq
    krairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsyd
    vppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkr
    vliaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvr
    kameavaaqgkakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gpiB (B:)
    ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
    airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
    pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
    iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvrka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gpiC (C:)
    maayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvq
    krairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsyd
    vppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkr
    vliaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvr
    kameavaaqgkakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gpiC (C:)
    aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
    rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
    ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
    liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgde