PDB entry 4gp4

View 4gp4 on RCSB PDB site
Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant Y133F from Thermus thermophilus
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Proton Pump
Deposited on 2012-08-20, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.182
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaA, TTHA1135
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ79 (Start-567)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d4gp4a_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaB, ctaC, TTHA1134
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gp4b1, d4gp4b2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide 2A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaD, TTHA1133
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gp4c_
  • Heterogens: CU, HEM, HAS, PER, OLC, CUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gp4A (A:)
    mhhhhhhavraseisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypl
    lkrllpfvqsyyqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmaf
    iglvvaalpllaneatvlftfypplkghwafylgasvfvlstwvsiyivldlwrrwkaan
    pgkvtplvtymavvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghp
    ivyfwllpayaiiytilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptw
    kmihsvltlfvavpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgll
    gfipggaggivnasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpis
    daqrrlglavvwlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlag
    ivllvalllfiyglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfava
    ailvvlaygptlvqlfghlnpvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gp4A (A:)
    srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg
    ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllane
    atvlftfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv
    fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiy
    tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp
    slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas
    ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw
    flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl
    fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq
    lfghlnpvpgwrlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gp4B (B:)
    mvdehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
    egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
    tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gp4B (B:)
    dehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
    pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
    invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gp4C (C:)
    meekpkgalavilvltltilvfwlgvyavffarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gp4C (C:)
    kpkgalavilvltltilvfwlgvyavffarg