PDB entry 4go2

View 4go2 on RCSB PDB site
Description: Crystal structure of the c-terminal domain of 10'formyltetrahydrofolate dehydrogenase in complex with Thio-NADP
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, FDH, OXIDOREDUCTASE
Deposited on 2012-08-18, released 2013-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.178
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosolic 10-formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4go2a_
  • Chain 'B':
    Compound: Cytosolic 10-formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4go2b_
  • Chain 'C':
    Compound: Cytosolic 10-formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4go2c_
  • Chain 'D':
    Compound: Cytosolic 10-formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4go2d_
  • Heterogens: SO4, GOL, TAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4go2A (A:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenciaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4go2A (A:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enciaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4go2B (B:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenciaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4go2B (B:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enciaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4go2C (C:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenciaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4go2C (C:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enciaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4go2D (D:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenciaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4go2D (D:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enciaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey