PDB entry 4gnz

View 4gnz on RCSB PDB site
Description: Crystal structure of the c707s mutant of c-terminal domain of 10'formyltetrahydrofolate dehydrogenase in complex with NADP
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, FDH, oxidoreductase
Deposited on 2012-08-17, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.181
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosolic 10-formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28037 (Start-516)
      • engineered mutation (321)
    Domains in SCOPe 2.07: d4gnza_
  • Chain 'B':
    Compound: Cytosolic 10-formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28037 (Start-516)
      • engineered mutation (321)
    Domains in SCOPe 2.07: d4gnzb_
  • Chain 'C':
    Compound: Cytosolic 10-formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28037 (Start-516)
      • engineered mutation (321)
    Domains in SCOPe 2.07: d4gnzc_
  • Chain 'D':
    Compound: Cytosolic 10-formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Aldh1l1, Fthfd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28037 (Start-516)
      • engineered mutation (321)
    Domains in SCOPe 2.07: d4gnzd_
  • Heterogens: NAP, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gnzA (A:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgensiaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gnzA (A:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    ensiaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gnzB (B:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgensiaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gnzB (B:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    ensiaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gnzC (C:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgensiaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gnzC (C:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    ensiaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gnzD (D:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgensiaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gnzD (D:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    ensiaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey