PDB entry 4gms

View 4gms on RCSB PDB site
Description: Crystal structure of heterosubtypic Fab S139/1 in complex with influenza A H3 hemagglutinin
Class: viral protein/immune system
Keywords: immunoglobulin, virus attachment and entry, immune recognition, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-08-16, released 2012-10-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.209
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:392809]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03435 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d4gmsa_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:392809]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:392809]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03435 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d4gmsc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:392809]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:392809]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03435 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d4gmse_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:392809]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab S139/1 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GMS (0-End)
  • Chain 'I':
    Compound: Fab S139/1 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GMS (0-End)
  • Chain 'J':
    Compound: Fab S139/1 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GMS (0-End)
  • Chain 'L':
    Compound: Fab S139/1 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GMS (0-End)
    Domains in SCOPe 2.03: d4gmsl1, d4gmsl2
  • Chain 'M':
    Compound: Fab S139/1 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GMS (0-End)
    Domains in SCOPe 2.03: d4gmsm1
  • Chain 'N':
    Compound: Fab S139/1 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GMS (0-End)
    Domains in SCOPe 2.03: d4gmsn1, d4gmsn2
  • Heterogens: NAG, SO4, GOL, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gmsA (A:)
    gatlclghhavpngtlvktitndqievtnatelvqssstgkicnnphrildginctlida
    llgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwtg
    vtqnggssackrgpdsgffsrlnwlyksgstypvqnvtmpnndnsdklyiwgvhhpstdk
    eqtnlyvqasgkvtvstkrsqqtiipnvgsrpwvrglssrisiywtivkpgdilvinsng
    nliaprgyfkmrtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpkyv
    kqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmsA (A:)
    gatlclghhavpngtlvktitndqievtnatelvqssstgkicnnphrildginctlida
    llgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwtg
    vtqnggssackrgpdsgffsrlnwlyksgstypvqnvtmpnndnsdklyiwgvhhpstdk
    eqtnlyvqasgkvtvstkrsqqtiipnvgsrpwvrglssrisiywtivkpgdilvinsng
    nliaprgyfkmrtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpkyv
    kqntlklatgmrnvpe
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gmsC (C:)
    gatlclghhavpngtlvktitndqievtnatelvqssstgkicnnphrildginctlida
    llgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwtg
    vtqnggssackrgpdsgffsrlnwlyksgstypvqnvtmpnndnsdklyiwgvhhpstdk
    eqtnlyvqasgkvtvstkrsqqtiipnvgsrpwvrglssrisiywtivkpgdilvinsng
    nliaprgyfkmrtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpkyv
    kqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmsC (C:)
    gatlclghhavpngtlvktitndqievtnatelvqssstgkicnnphrildginctlida
    llgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwtg
    vtqnggssackrgpdsgffsrlnwlyksgstypvqnvtmpnndnsdklyiwgvhhpstdk
    eqtnlyvqasgkvtvstkrsqqtiipnvgsrpwvrglssrisiywtivkpgdilvinsng
    nliaprgyfkmrtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpkyv
    kqntlklatgmrnvpe
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gmsE (E:)
    gatlclghhavpngtlvktitndqievtnatelvqssstgkicnnphrildginctlida
    llgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwtg
    vtqnggssackrgpdsgffsrlnwlyksgstypvqnvtmpnndnsdklyiwgvhhpstdk
    eqtnlyvqasgkvtvstkrsqqtiipnvgsrpwvrglssrisiywtivkpgdilvinsng
    nliaprgyfkmrtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpkyv
    kqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmsE (E:)
    gatlclghhavpngtlvktitndqievtnatelvqssstgkicnnphrildginctlida
    llgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwtg
    vtqnggssackrgpdsgffsrlnwlyksgstypvqnvtmpnndnsdklyiwgvhhpstdk
    eqtnlyvqasgkvtvstkrsqqtiipnvgsrpwvrglssrisiywtivkpgdilvinsng
    nliaprgyfkmrtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpkyv
    kqntlklatgmrnvpe
    

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4gmsL (L:)
    divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
    rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmsL (L:)
    divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
    rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4gmsM (M:)
    divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
    rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmsM (M:)
    divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
    rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifps
    vvcflnnfypkdigvlnswtdqdskdstysmsstlt
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4gmsN (N:)
    divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
    rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmsN (N:)
    divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
    rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne