PDB entry 4gme

View 4gme on RCSB PDB site
Description: Crystal structure of mannonate dehydratase (target EFI-502209) from caulobacter crescentus cb15 complexed with magnesium and d-mannonate
Class: lyase
Keywords: enolase, magnesium binding site, enzyme function initiative, efi, lyase
Deposited on 2012-08-15, released 2012-09-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-09-12, with a file datestamp of 2012-09-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme family
    Species: CAULOBACTER CRESCENTUS [TaxId:190650]
    Gene: CC_0532
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gmea1, d4gmea2
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme family
    Species: CAULOBACTER CRESCENTUS [TaxId:190650]
    Gene: CC_0532
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gmec1, d4gmec2
  • Heterogens: MG, CL, GOL, CO3, CS2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gmeA (A:)
    mhhhhhhssgvdlgtenlyfqsmmlkiidakvivtcpgrnfvtlkittedgitgvgdatl
    ngrelsvvsflqdhmvpsligrdahqiediwqffyrgsywrggpvamtalaavdmalwdi
    kgkvaglpvyqllggacrtgvtvyghangetiedtiaeavkykamgykairlqtgvpgla
    stygvskdkmfyepadndlpteniwstakylnsvpklferarevlgwdvhllhdvhhrlt
    pieaarlgkdlepyrlfwledsvpaenqagfrlirqhtttplavgeifahvwdakqliee
    qlidylratvlhaggitnlkkiaafadlhhvktgchgatdlspvtmaaalhfdmsitnfg
    lqeymrhtpetdavfphaytfsdgmlhpgdkpglgvdidedlaakhpykraylpvnrled
    gtmfnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmeA (A:)
    mlkiidakvivtcpgrnfvtlkittedgitgvgdatlngrelsvvsflqdhmvpsligrd
    ahqiediwqffyrgsywrggpvamtalaavdmalwdikgkvaglpvyqllggacrtgvtv
    yghangetiedtiaeavkykamgykairlqtgvpglastygvskdkmfyepadndlpten
    iwstakylnsvpklferarevlgwdvhllhdvhhrltpieaarlgkdlepyrlfwledsv
    paenqagfrlirqhtttplavgeifahvwdakqlieeqlidylratvlhaggitnlkkia
    afadlhhvktgchgatdlspvtmaaalhfdmsitnfglqeymrhtpetdavfphaytfsd
    gmlhpgdkpglgvdidedlaakhpykraylpvnrledgtmfnw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gmeC (C:)
    mhhhhhhssgvdlgtenlyfqsmmlkiidakvivtcpgrnfvtlkittedgitgvgdatl
    ngrelsvvsflqdhmvpsligrdahqiediwqffyrgsywrggpvamtalaavdmalwdi
    kgkvaglpvyqllggacrtgvtvyghangetiedtiaeavkykamgykairlqtgvpgla
    stygvskdkmfyepadndlpteniwstakylnsvpklferarevlgwdvhllhdvhhrlt
    pieaarlgkdlepyrlfwledsvpaenqagfrlirqhtttplavgeifahvwdakqliee
    qlidylratvlhaggitnlkkiaafadlhhvktgchgatdlspvtmaaalhfdmsitnfg
    lqeymrhtpetdavfphaytfsdgmlhpgdkpglgvdidedlaakhpykraylpvnrled
    gtmfnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmeC (C:)
    mlkiidakvivtcpgrnfvtlkittedgitgvgdatlngrelsvvsflqdhmvpsligrd
    ahqiediwqffyrgsywrggpvamtalaavdmalwdikgkvaglpvyqllggacrtgvtv
    yghangetiedtiaeavkykamgykairlqtgvpglastygvskdkmfyepadndlpten
    iwstakylnsvpklferarevlgwdvhllhdvhhrltpieaarlgkdlepyrlfwledsv
    paenqagfrlirqhtttplavgeifahvwdakqlieeqlidylratvlhaggitnlkkia
    afadlhhvktgchgatdlspvtmaaalhfdmsitnfglqeymrhtpetdavfphaytfsd
    gmlhpgdkpglgvdidedlaakhpykraylpvnrledgtmfnw