PDB entry 4gmd

View 4gmd on RCSB PDB site
Description: The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with AZT Monophosphate
Class: Transferase/Inhibitor
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Structures of Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors, MTBI, PROTEIN STRUCTURE INITIATIVE, TRANSFERASE, Transferase-Inhibitor complex
Deposited on 2012-08-15, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.18
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2962, tmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gmda_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2962, tmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gmdb_
  • Chain 'C':
    Compound: thymidylate kinase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2962, tmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gmdc_
  • Chain 'D':
    Compound: thymidylate kinase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA2962, tmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gmdd_
  • Heterogens: ATM, CL, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gmdA (A:)
    snamtglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllaps
    depmaadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpearia
    alesfvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqa
    peryqvldaglplaevqagldrllpnllerlng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmdA (A:)
    tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
    aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
    fvqgdlrpdltlvfdlpveigargrldrfeqedrrffeavrqtylqraaqaperyqvlda
    glplaevqagldrllpnllerln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gmdB (B:)
    snamtglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllaps
    depmaadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpearia
    alesfvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqa
    peryqvldaglplaevqagldrllpnllerlng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmdB (B:)
    tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
    aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
    fvqgdlrpdltlvfdlpvedrfeqedrrffeavrqtylqraaqaperyqvldaglplaev
    qagldrllpnllerl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gmdC (C:)
    snamtglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllaps
    depmaadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpearia
    alesfvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqa
    peryqvldaglplaevqagldrllpnllerlng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmdC (C:)
    tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
    aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
    fvqgdlrpdltlvfdlpvrldrfeqedrrffeavrqtylqraaqaperyqvldaglplae
    vqagldrllpnllerln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gmdD (D:)
    snamtglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllaps
    depmaadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpearia
    alesfvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqa
    peryqvldaglplaevqagldrllpnllerlng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gmdD (D:)
    tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
    aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
    fvqgdlrpdltlvfdlpvldrfeqedrrffeavrqtylqraaqaperyqvldaglplaev
    qagldrllpnllerln