PDB entry 4gm1

View 4gm1 on RCSB PDB site
Description: Crystal Structure of Benzoylformate Decarboxylase Mutant L403S
Class: lyase
Keywords: decarboxylase, thiamin thiazolone diphosphate cofactor, lyase
Deposited on 2012-08-15, released 2013-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Benzoylformate decarboxylase
    Species: Pseudomonas putida [TaxId:303]
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906
      • engineered mutation (402)
    Domains in SCOPe 2.07: d4gm1a1, d4gm1a2, d4gm1a3
  • Heterogens: CA, NA, GOL, TZD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gm1A (A:)
    masvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqa
    srkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlpr
    plvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvs
    ssvrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprc
    pfptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtc
    dpleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfd
    tlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaaggsgfalpaaigvqlaeper
    qviavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpg
    idfralakgygvqalkadnleqlkgslqealsakgpvlievstvspvkrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gm1A (A:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaaggsgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvsp