PDB entry 4gkz

View 4gkz on RCSB PDB site
Description: HA1.7, a MHC class II restricted TCR specific for haemagglutinin
Class: immune system
Keywords: Major histocompatibility complex class II (pMHC-II), T-cell, T-cell receptor (TCR), influenza, HA1.7, IMMUNE SYSTEM
Deposited on 2012-08-13, released 2012-11-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.251
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha chain of Class II TCR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GKZ (0-201)
    Domains in SCOPe 2.04: d4gkza1, d4gkza2
  • Chain 'B':
    Compound: Beta Chain of Class II TCR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GKZ (0-240)
    Domains in SCOPe 2.04: d4gkzb1, d4gkzb2
  • Heterogens: EDO, SO4, TAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gkzA (A:)
    mqsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgi
    ngfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipniqnp
    dpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
    snksdfacanafnnsiipedtf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gkzB (B:)
    vkvtqssrylvkrtgekvflecvqdmdhenmfwyrqdpglglrliyfsydvkmkekgdip
    egysvsrekkerfslilesastnqtsmylcassstglpygytfgsgtrltvvedlnkvfp
    pevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    a