PDB entry 4gku

View 4gku on RCSB PDB site
Description: Crystal structure of beta lactamase in PET-15B
Class: hydrolase
Keywords: beta lactamase, HYDROLASE
Deposited on 2012-08-13, released 2012-10-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.166
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4gkua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gkuA (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw