PDB entry 4gk1

View 4gk1 on RCSB PDB site
Description: Crystal structure of CD23 lectin domain mutant D270A
Class: immune system
Keywords: Receptor, IMMUNE SYSTEM
Deposited on 2012-08-10, released 2013-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d4gk1a_
  • Chain 'B':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d4gk1b_
  • Chain 'C':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d4gk1c_
  • Chain 'D':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (114)
    Domains in SCOPe 2.07: d4gk1d_
  • Chain 'E':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734 (0-End)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d4gk1e_
  • Chain 'F':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (114)
    Domains in SCOPe 2.07: d4gk1f_
  • Chain 'G':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (114)
    Domains in SCOPe 2.07: d4gk1g_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gk1A (A:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gk1A (A:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
    klgawvcdrlatct
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gk1B (B:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gk1B (B:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
    klgawvcdrlatc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gk1C (C:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gk1C (C:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
    klgawvcdrlatctp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gk1D (D:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gk1D (D:)
    vcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtg
    swiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdrklg
    awvcdrlatctp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gk1E (E:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gk1E (E:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
    klgawvcdrlatct
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4gk1F (F:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gk1F (F:)
    vcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtg
    swiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdrklg
    awvcdrlatctpp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4gk1G (G:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gk1G (G:)
    cntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtgs
    wiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdrklga
    wvcdrlatc