PDB entry 4gjx

View 4gjx on RCSB PDB site
Description: Crystal structure of CD23 lectin domain mutant D258A
Class: immune system
Keywords: Receptor, IMMUNE SYSTEM
Deposited on 2012-08-10, released 2013-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (102)
    Domains in SCOPe 2.06: d4gjxa_
  • Chain 'B':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (102)
    Domains in SCOPe 2.06: d4gjxb_
  • Chain 'C':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (102)
    Domains in SCOPe 2.06: d4gjxc_
  • Chain 'D':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (102)
    Domains in SCOPe 2.06: d4gjxd_
  • Chain 'E':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (102)
    Domains in SCOPe 2.06: d4gjxe_
  • Chain 'F':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (102)
    Domains in SCOPe 2.06: d4gjxf_
  • Chain 'G':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (102)
    Domains in SCOPe 2.06: d4gjxg_
  • Chain 'H':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (102)
    Domains in SCOPe 2.06: d4gjxh_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gjxA (A:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjxA (A:)
    fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
    gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl
    gawvcdrlatctppa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gjxB (B:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjxB (B:)
    fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
    gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl
    gawvcdrlatctppa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gjxC (C:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjxC (C:)
    fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
    gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl
    gawvcdrlatctpp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gjxD (D:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjxD (D:)
    fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
    gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl
    gawvcdrlatctppa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gjxE (E:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjxE (E:)
    fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
    gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl
    gawvcdrlatctppa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4gjxF (F:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjxF (F:)
    fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
    gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl
    gawvcdrlatctppa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4gjxG (G:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjxG (G:)
    fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
    gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl
    gawvcdrlatctppa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4gjxH (H:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gjxH (H:)
    fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
    gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl
    gawvcdrlatctpp