PDB entry 4gj0

View 4gj0 on RCSB PDB site
Description: Crystal structure of CD23 lectin domain mutant S252A
Class: immune system
Keywords: Receptor, IMMUNE SYSTEM
Deposited on 2012-08-09, released 2013-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.169
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4gj0a_
  • Chain 'B':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4gj0b_
  • Chain 'C':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4gj0c_
  • Chain 'D':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4gj0d_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gj0A (A:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptarsqgedcvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gj0A (A:)
    gfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhash
    tgswiglrnldlkgefiwvdgshvdysnwapgeptarsqgedcvmmrgsgrwndafcdrk
    lgawvcdrlatctpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gj0B (B:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptarsqgedcvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gj0B (B:)
    fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
    gswiglrnldlkgefiwvdgshvdysnwapgeptarsqgedcvmmrgsgrwndafcdrkl
    gawvcdrlatctpp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gj0C (C:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptarsqgedcvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gj0C (C:)
    vcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtg
    swiglrnldlkgefiwvdgshvdysnwapgeptarsqgedcvmmrgsgrwndafcdrklg
    awvcdrlatctp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gj0D (D:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgeptarsqgedcvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gj0D (D:)
    vcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtg
    swiglrnldlkgefiwvdgshvdysnwapgeptarsqgedcvmmrgsgrwndafcdrklg
    awvcdrlatc