PDB entry 4gi0

View 4gi0 on RCSB PDB site
Description: Crystal structure of CD23 lectin domain mutant E249A
Class: immune system
Keywords: Receptor, IMMUNE SYSTEM
Deposited on 2012-08-08, released 2013-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.207
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (93)
    Domains in SCOPe 2.07: d4gi0a_
  • Chain 'B':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (93)
    Domains in SCOPe 2.07: d4gi0b_
  • Chain 'C':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, CD23A, CLEC4J, FCE2, IGEBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06734
      • engineered mutation (93)
    Domains in SCOPe 2.07: d4gi0c_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gi0A (A:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgaptsrsqgedcvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gi0A (A:)
    gfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhash
    tgswiglrnldlkgefiwvdgshvdysnwapgaptsrsqgedcvmmrgsgrwndafcdrk
    lgawvcdrlatctppa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gi0B (B:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgaptsrsqgedcvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gi0B (B:)
    cntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtgs
    wiglrnldlkgefiwvdgshvdysnwapgaptsrsqgedcvmmrgsgrwndafcdrklga
    wvcdrlatc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gi0C (C:)
    sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
    htgswiglrnldlkgefiwvdgshvdysnwapgaptsrsqgedcvmmrgsgrwndafcdr
    klgawvcdrlatctppasegsae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gi0C (C:)
    fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
    gswiglrnldlkgefiwvdgshvdysnwapgaptsrsqgedcvmmrgsgrwndafcdrkl
    gawvcdrlatctppa