PDB entry 4ggb

View 4ggb on RCSB PDB site
Description: Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, TARGET EFI-500704, WITH BOUND CA, DISORDERED LOOPS
Class: isomerase
Keywords: ENOLASE, proposed galactarolactone cycloisomerase, enzyme function initiative, EFI, Structural Genomics, isomerase
Deposited on 2012-08-06, released 2012-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: Atu3139
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ggba1, d4ggba2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ggbA (A:)
    mkitavrthllehrldtpfesasmrfdrrahvlveiecddgtvgwgeclgparpnaavvq
    aysgwligqdprqtekiwavlynalrdqgqrglsltalsgidialwdikgkhygasisml
    lggrwresvrayatgsfkrdnvdrvsdnasemaerraegfhackikigfgveedlrviaa
    vreaigpdmrlmidanhgytvteaitlgdraagfgidwfeepvvpeqldayarvragqpi
    pvaggetwhgrygmwqalsagavdilqpdlcgcggfseiqkiatlatlhgvrivphvwgt
    gvqiaaalqfmaamtpdpvrvnpiepimefdrthnpfrqavlrepleavngvvtipdgpg
    lgieinrdaltefrmpdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ggbA (A:)
    mkitavrthllhvlveiecddgtvgwgeclgparpnaavvqaysgwligqdprqtekiwa
    vlynalrdqgqrglsltalsgidialwdikgkhygasismllggrwresvrayatgdrvs
    dnasemaerraegfhackikigfgveedlrviaavreaigpdmrlmidanhgytvteait
    lgdraagfgidwfeepvvpeqldayarvragqpipvaggetwhgrygmwqalsagavdil
    qpdlcgcggfseiqkiatlatlhgvrivphvwgtgvqiaaalqfmaamtpdpvrvnpiep
    imefdrthnpfrqavlrepleavngvvtipdgpglgieinrdaltefr