PDB entry 4gft

View 4gft on RCSB PDB site
Description: Malaria invasion machinery protein-Nanobody complex
Class: protein binding, immune system
Keywords: Malaria invasion machinery protein, PROTEIN BINDING, MTIP, MYOA TAIL INTERACTING PROTEIN, IMMUNE SYSTEM, NANOBODY
Deposited on 2012-08-03, released 2013-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin a tail domain interacting protein
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: MTIP, PFL2225w
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I4W8 (Start-68)
      • engineered mutation (19)
    Domains in SCOPe 2.07: d4gfta_
  • Chain 'B':
    Compound: Nanobody
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4GFT (0-End)
    Domains in SCOPe 2.07: d4gftb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gftA (A:)
    gdkdnveelikmfahfdnnstgyltksqmknilttwgdaltdqeaidalnafssednidy
    klfcedilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gftA (A:)
    nveelikmfahfdnnstgyltksqmknilttwaltdqeaidalnafssednidyklfced
    ilq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gftB (B:)
    evqlqesgggtvqpggslklscsaaperafsnyamgwfrqapgqerefvagitgsgrsqy
    yadsvkgrftisrdnamnavylqmnsvkaedtavyycaarvvpvfsdstkgyvywgqgtq
    vtvsshhhhhhepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gftB (B:)
    evqlqesgggtvqpggslklscsaaperafsnyamgwfrqapgqerefvagitgsgrsqy
    yadsvkgrftisrdnamnavylqmnsvkaedtavyycaarvvpvfsdstkgyvywgqgtq
    vtvssh