PDB entry 4gfg

View 4gfg on RCSB PDB site
Description: Crystal structure of spleen tyrosine kinase complexed with r9021
Class: transferase/transferase inhibitor
Keywords: SYK, SPLEEN TYPROSINE KINASE, PYRIMIDINE-5-CARBOXAMIDE, ATP-BINDING, HOST-VIRUS INTERACTION, NUCLEOTIDE-BINDING, PHOSPHOPROTEIN, SH2 DOMAIN, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-08-03, released 2013-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-282)
      • expression tag (283-286)
    Domains in SCOPe 2.07: d4gfga1, d4gfga2
  • Heterogens: 0XF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gfgA (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gfgA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
    vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
    kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
    cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
    dlmnlcwtydvenrpgfaavelrlrnyyydvvneghh