PDB entry 4gcv

View 4gcv on RCSB PDB site
Description: Structure of a Putative transcription factor (PA1374)from Pseudomonas aeruginosa
Class: transcription
Keywords: helex-turn-helex, transcription factor, DNA binding, TRANSCRIPTION
Deposited on 2012-07-31, released 2013-07-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcva_
  • Chain 'B':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcvb_
  • Chain 'C':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcvc_
  • Chain 'D':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcvd_
  • Chain 'E':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcve_
  • Chain 'F':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcvf_
  • Chain 'G':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcvg_
  • Chain 'H':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcvh_
  • Chain 'I':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcvi_
  • Chain 'J':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcvj_
  • Chain 'K':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcvk_
  • Chain 'L':
    Compound: Putative transcription protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA1374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3X0
      • engineered mutation (105-106)
    Domains in SCOPe 2.04: d4gcvl_
  • Heterogens: NA, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gcvA (A:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvA (A:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysqrpryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaalad
    grtvpleqctvqagpaaseemrqrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gcvB (B:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvB (B:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaala
    dgrtvpleqctvqagpaaseemrqrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gcvC (C:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvC (C:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysyqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaaladgrtv
    pleqctvqagpaaseemrqrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gcvD (D:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvD (D:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysyqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaaladgrtv
    pleqctvqagpaaseemrqrl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gcvE (E:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvE (E:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysqyqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaaladgrt
    vpleqctvqagpaaseemrqrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4gcvF (F:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvF (F:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaala
    dgrtvpleqctvqagpaaseemrqrl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4gcvG (G:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvG (G:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysyqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaaladgrtv
    pleqctvqagpaaseemrqrl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4gcvH (H:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvH (H:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaala
    dgrtvpleqctvqagpaaseemrqrl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4gcvI (I:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvI (I:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysyqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaaladgrtv
    pleqctvqagpaaseemrqrl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4gcvJ (J:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvJ (J:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysyqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaaladgrtv
    pleqctvqagpaaseemrqrl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4gcvK (K:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvK (K:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaala
    dgrtvpleqctvqagpaaseemrqrl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4gcvL (L:)
    mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
    veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
    pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gcvL (L:)
    cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
    ysyqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaaladgrtv
    pleqctvqagpaaseemrqrl