PDB entry 4gbo

View 4gbo on RCSB PDB site
Description: Structure of T.fusca E7
Class: oxidoreductase
Keywords: CBM33, polysaccharide monooxygenase, OXIDOREDUCTASE
Deposited on 2012-07-27, released 2014-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e7
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Gene: Tfu_1268
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gboa_
  • Chain 'B':
    Compound: e7
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Gene: Tfu_1268
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4gbob_
  • Heterogens: CU, NA, GOL, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gboA (A:)
    mhrysrtgkhrwtvralavlftallgltqwtapasahgsvinpatrnygcwlrwghdhln
    pnmqyedpmcwqawqdnpnamwnwnglyrdwvggnhraalpdgqlcsgglteggryrsmd
    avgpwkttdvnntftihlydqashgadyflvyvtkqgfdpttqpltwdslelvhqtgsyp
    paqniqftvhapnrsgrhvvftiwkashmdqtyylcsdvnfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gboA (A:)
    hgsvinpatrnygcwlrwghdhlnpnmqyedpmcwqawqdnpnamwnwnglyrdwvggnh
    raalpdgqlcsgglteggryrsmdavgpwkttdvnntftihlydqashgadyflvyvtkq
    gfdpttqpltwdslelvhqtgsyppaqniqftvhapnrsgrhvvftiwkashmdqtyylc
    sdvnfv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gboB (B:)
    mhrysrtgkhrwtvralavlftallgltqwtapasahgsvinpatrnygcwlrwghdhln
    pnmqyedpmcwqawqdnpnamwnwnglyrdwvggnhraalpdgqlcsgglteggryrsmd
    avgpwkttdvnntftihlydqashgadyflvyvtkqgfdpttqpltwdslelvhqtgsyp
    paqniqftvhapnrsgrhvvftiwkashmdqtyylcsdvnfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gboB (B:)
    hgsvinpatrnygcwlrwghdhlnpnmqyedpmcwqawqdnpnamwnwnglyrdwvggnh
    raalpdgqlcsgglteggryrsmdavgpwkttdvnntftihlydqashgadyflvyvtkq
    gfdpttqpltwdslelvhqtgsyppaqniqftvhapnrsgrhvvftiwkashmdqtyylc
    sdvnfv