PDB entry 4gay

View 4gay on RCSB PDB site
Description: Structure of the broadly neutralizing antibody AP33
Class: immune system
Keywords: antibody Fab, neutralizing antibody, HCV E2, IMMUNE SYSTEM
Deposited on 2012-07-26, released 2012-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.247
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutralizing antibody ap33 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GAY
  • Chain 'B':
    Compound: neutralizing antibody ap33 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GAY (0-End)
    Domains in SCOPe 2.06: d4gayb1, d4gayb2
  • Chain 'H':
    Compound: neutralizing antibody ap33 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GAY (Start-217)
  • Chain 'L':
    Compound: neutralizing antibody ap33 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GAY (0-End)
    Domains in SCOPe 2.06: d4gayl1, d4gayl2
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gayB (B:)
    nivltqspvslavslgqratiscrasesvdgygnsflhwfqqkpgqppklliylasnlns
    gvparfsgsgsrtdftltidpveaddaatyycqqnnvdpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gayB (B:)
    nivltqspvslavslgqratiscrasesvdgygnsflhwfqqkpgqppklliylasnlns
    gvparfsgsgsrtdftltidpveaddaatyycqqnnvdpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4gayL (L:)
    nivltqspvslavslgqratiscrasesvdgygnsflhwfqqkpgqppklliylasnlns
    gvparfsgsgsrtdftltidpveaddaatyycqqnnvdpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gayL (L:)
    nivltqspvslavslgqratiscrasesvdgygnsflhwfqqkpgqppklliylasnlns
    gvparfsgsgsrtdftltidpveaddaatyycqqnnvdpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgsengvlnswtdqdskdstysmsst
    ltltkdeyerhnsytceathktstspivksfnr