PDB entry 4gax

View 4gax on RCSB PDB site
Description: Crystal Structure of an alpha-Bisabolol synthase mutant
Class: lyase
Keywords: sesquiterpene synthase, LYASE
Deposited on 2012-07-26, released 2013-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.178
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amorpha-4,11-diene synthase
    Species: Artemisia annua [TaxId:35608]
    Gene: AaBOS, AMS1, KCS12
    Database cross-references and differences (RAF-indexed):
    • PDB 4GAX (Start-562)
    Domains in SCOPe 2.06: d4gaxa1, d4gaxa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gaxA (A:)
    gshmasmtggqqmgrgsmslteekpirpianfspsiwgdqflivdnqveqgveqivkdlk
    kevrqllkealdipmkhanllklvdeiqrlgisylfeqeidhalqhiyetygdnwsgars
    slwfrlmrkqgyfvtcdvfnnhkdesgvfkqslknhvegllelyeatsmrvpgeiileda
    lvftqshlsiiakdtlsinpalsteiqralkkplwkrlprieavqyipfyeqqdshnktl
    iklaklefnllqslhreelsqlskwwkafdvknnapysrdrivecyfwalasrfepqysr
    ariflakvialvtliddiydaygtyeelkifteaierwsitcldmipeymkpiyklfmdt
    ytemeeilakegktnifncgkefvkdfvrnlmveaqwaneghiptteeldsvavitggan
    lltttcylgmsdivtkeafewavseppllrykgilgrrlndlaghkeeqerkhvsssves
    ymkeynvseeyaknllykqvedlwkdinreylitktiprpllvavinlvhfldvlyaakd
    aftamgeeyknlvksllvypmsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gaxA (A:)
    anfspsiwgdqflivdnqveqgveqivkdlkkevrqllkealdipmkhanllklvdeiqr
    lgisylfeqeidhalqhiyetygdnwsgarsslwfrlmrkqgyfvtcdvfnnhkdesgvf
    kqslknhvegllelyeatsmrvpgeiiledalvftqshlsiiakdtlsinpalsteiqra
    lkkplwkrlprieavqyipfyeqqdshnktliklaklefnllqslhreelsqlskwwkaf
    dvknnapysrdrivecyfwalasrfepqysrariflakvialvtliddiydaygtyeelk
    ifteaierwsitcldmipeymkpiyklfmdtytemeeilakegktnifncgkefvkdfvr
    nlmveaqwaneghiptteeldsvavitgganlltttcylgmsdivtkeafewavseppll
    rykgilgrrlndlaghsssvesymkeynvseeyaknllykqvedlwkdinreylitktip
    rpllvavinlvhfldvlyaakdaftamgeeyknlvksllvypmsi