PDB entry 4gam

View 4gam on RCSB PDB site
Description: Complex structure of Methane monooxygenase hydroxylase and regulatory subunit
Class: oxidoreductase
Keywords: Methane Monooxygenase, hydroxylase, regulatory subunit B, OXIDOREDUCTASE
Deposited on 2012-07-25, released 2013-02-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methane monooxygenase component A alpha chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Methane monooxygenase component A beta chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Methane monooxygenase component A gamma chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Methane monooxygenase regulatory protein B
    Species: Methylococcus capsulatus [TaxId:243233]
    Gene: mmoB, MCA1196
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Methane monooxygenase component A alpha chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Methane monooxygenase component A beta chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Methane monooxygenase component A gamma chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Methane monooxygenase regulatory protein B
    Species: Methylococcus capsulatus [TaxId:243233]
    Gene: mmoB, MCA1196
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Methane monooxygenase component A alpha chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Methane monooxygenase component A beta chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Methane monooxygenase component A gamma chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Methane monooxygenase regulatory protein B
    Species: Methylococcus capsulatus [TaxId:243233]
    Gene: mmoB, MCA1196
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Methane monooxygenase component A alpha chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Methane monooxygenase component A beta chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4gamq_
  • Chain 'R':
    Compound: Methane monooxygenase component A gamma chain
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4gamr_
  • Chain 'S':
    Compound: Methane monooxygenase regulatory protein B
    Species: Methylococcus capsulatus [TaxId:243233]
    Gene: mmoB, MCA1196
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4gams_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4gamQ (Q:)
    msmlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpna
    dwiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewryt
    drflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvsla
    fwgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfd
    wnesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyy
    nclgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvv
    ddwiedyasridfkadrdqivkavlaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gamQ (Q:)
    smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
    wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
    rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
    wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
    nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
    clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
    dwiedyasridfkadrdqivkavlaglk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4gamR (R:)
    maklgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakl
    eekvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykp
    pimpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gamR (R:)
    klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
    kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
    mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4gamS (S:)
    msvnsnaydagimglkgkdfadqffadenqvvhesdtvvlvlkksdeintfieeilltdy
    kknvnptvnvedragywwikangkievdcdeisellgrqfnvydflvdvsstigraytlg
    nkftitselmgldrkledyha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gamS (S:)
    svnsnaydagimglkgkdfadqffadenqvvhesdtvvlvlkksdeintfieeilltdyk
    knvnptvnvedragywwikangkievdcdeisellgrqfnvydflvdvsstigraytlgn
    kftitselmgld