PDB entry 4g9s

View 4g9s on RCSB PDB site
Description: Crystal structure of Escherichia coli PliG in complex with Atlantic salmon g-type lysozyme
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase inhibitor, lysozyme, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-07-24, released 2012-11-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.129
AEROSPACI score: 1.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Goose-type lysozyme
    Species: Salmo salar [TaxId:8030]
    Gene: lysG, LYG
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6PZ97 (8-186)
      • expression tag (0-7)
      • engineered mutation (134)
    Domains in SCOPe 2.05: d4g9sa_
  • Chain 'B':
    Compound: Inhibitor of g-type lysozyme
    Species: Escherichia coli [TaxId:562]
    Gene: pliG, ycgK
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4g9sA (A:)
    hhhhhhhmditkvdtsgaseitarqdkltlqgvdashklaehdlvrmnkykelitrvgqk
    hgldpaiiagiisresragsaldhgwgdhgkgfglmqvdkryhkivgawdsekhisqgte
    iliefirriqakfpvwpkehqlkggisaynagdknvrtyermdvgttggdysndvvarsq
    wfksqgy
    

  • Chain 'B':
    No sequence available.