PDB entry 4g92

View 4g92 on RCSB PDB site
Description: CCAAT-binding complex from Aspergillus nidulans with DNA
Class: Transcription/DNA
Keywords: transcription factor, nucleosome, minor groove binding, CCAAT-binding complex, histone fold motif, specific binding to the CCAAT-box, DNA, nucleus, Transcription-DNA complex
Deposited on 2012-07-23, released 2012-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.158
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HAPB protein
    Species: Emericella nidulans [TaxId:162425]
    Gene: hapB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription factor HapC (Eurofung)
    Species: Aspergillus nidulans [TaxId:227321]
    Gene: AN4034.2, ANIA_04034
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5B5Z6 (1-91)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d4g92b_
  • Chain 'C':
    Compound: HapE
    Species: Aspergillus nidulans [TaxId:227321]
    Gene: AN6492.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA
  • Chain 'E':
    Compound: DNA
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4g92B (B:)
mkeqdrwlpianvarimklalpenakiakeakecmqecvsefisfitseasekcqqekrk
tvngedilfamtslgfenyaealkiylskyre

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.