PDB entry 4g8f

View 4g8f on RCSB PDB site
Description: Crystal Structure of clone42 TCR
Class: immune system
Keywords: TCR, T cell, CD1b, GMM, lipid recognition, IMMUNE SYSTEM
Deposited on 2012-07-23, released 2013-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha chain clone 42 TCR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4G8F
    Domains in SCOPe 2.07: d4g8fa1, d4g8fa2
  • Chain 'B':
    Compound: beta chain clone 42 TCR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4G8F (0-242)
    Domains in SCOPe 2.07: d4g8fb1, d4g8fb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g8fA (A:)
    gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
    ssflsrskgysylllkelqmkdsasylcavrntggfktifgagtrlfvkaniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g8fA (A:)
    nidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfss
    flsrskgysylllkelqmkdsasylcavrngfktifgagtrlfvkaniqnpdpavyqlrd
    skssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfaca
    nafn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4g8fB (B:)
    nagvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgev
    pdgynvsrlkkqnfllglesaapsqtsvyfcassprlagdeqffgpgtrltvledlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad